PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32119.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Dof
Protein Properties Length: 307aa    MW: 33056.9 Da    PI: 9.6437
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32119.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.9e-3969129262
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +e+alkcprCdstntkfCy+nnyslsqPr+fCk+CrryWt GGalrnvPvGgg+r+nkk++
  KHN32119.1  69 PEAALKCPRCDSTNTKFCYFNNYSLSQPRHFCKTCRRYWTSGGALRNVPVGGGCRRNKKNK 129
                 57889*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3353122IPR003851Zinc finger, Dof-type
PfamPF027015.3E-3372127IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5973127IPR003851Zinc finger, Dof-type
PROSITE patternPS01361075111IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVFSSIPVFV DPPNWQQQPN HPQASNNGGD NSQLLPPLPP HQPHVGGSVG SIRPGSMADR  60
ARLAKIPPPE AALKCPRCDS TNTKFCYFNN YSLSQPRHFC KTCRRYWTSG GALRNVPVGG  120
GCRRNKKNKR SRSKSPASSE KQTLSGSTSA TPSGGTTHEL VGQLPQPPNL PFMASLQNLN  180
RYAVGNMGLG LREIHGQNEN MGFQIGNSSA AGGGMDQWRI QQVPFLNGFE STSAGSYPFQ  240
NEGIETPSGF GGDIATNSRV SQMPSVKMEE SGALNLSRST LNVSENNQYY SWTDMSGLAS  300
SSATHLL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2352950.0AC235295.1 Glycine max strain Williams 82 clone GM_WBb0059N17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003539681.10.0PREDICTED: dof zinc finger protein DOF3.6
TrEMBLA0A0B2RIH20.0A0A0B2RIH2_GLYSO; Dof zinc finger protein DOF3.6
TrEMBLK7LTC40.0K7LTC4_SOYBN; Uncharacterized protein
STRINGGLYMA12G06880.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.14e-48OBF-binding protein 3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]